Protein Info for BWI76_RS24830 in Klebsiella michiganensis M5al

Annotation: 5-keto-4-deoxy-D-glucarate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 94% identical to GARL_CITK8: 5-keto-4-deoxy-D-glucarate aldolase (garL) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K01630, 2-dehydro-3-deoxyglucarate aldolase [EC: 4.1.2.20] (inferred from 96% identity to cro:ROD_47531)

MetaCyc: 93% identical to alpha-dehydro-beta-deoxy-D-glucarate aldolase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxyglucarate aldolase. [EC: 4.1.2.20]

Predicted SEED Role

"2-dehydro-3-deoxyglucarate aldolase (EC 4.1.2.20)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.1.2.20)

MetaCyc Pathways

superpathway of D-glucarate and D-galactarate degradation (5/5 steps found)
D-glucarate degradation I (4/4 steps found)
D-galactarate degradation I (4/4 steps found)
superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)

KEGG Metabolic Maps

Ascorbate and aldarate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAP9 at UniProt or InterPro

Protein Sequence (256 amino acids)

>BWI76_RS24830 5-keto-4-deoxy-D-glucarate aldolase (Klebsiella michiganensis M5al)
MNNDIFPNKFKAALAAHQVQIGCWSALASPISTEVLGLAGFDWLVLDGEHAPNDISTFIP
QLMALKGSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETEEQAVNAVASTRYPPEGI
RGVSVSHRANMFGTVPDYFAQSNKNITILVQIESQQGVDNVDAIAATPGVDGIFVGPSDL
AAALGHLGNASHPEVQEAIQHIFASAKKHGKPSGILAPVEADARRYLEWGATFVAVGSDL
GVFRSATQKLADSFKK