Protein Info for BWI76_RS24715 in Klebsiella michiganensis M5al

Annotation: serine/threonine transporter SstT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 42 to 72 (31 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 184 to 207 (24 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details amino acids 291 to 316 (26 residues), see Phobius details amino acids 328 to 353 (26 residues), see Phobius details amino acids 363 to 380 (18 residues), see Phobius details PF00375: SDF" amino acids 19 to 398 (380 residues), 219.5 bits, see alignment E=4e-69

Best Hits

Swiss-Prot: 94% identical to SSTT_KLEP3: Serine/threonine transporter SstT (sstT) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_03990)

MetaCyc: 88% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium:dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9L9 at UniProt or InterPro

Protein Sequence (415 amino acids)

>BWI76_RS24715 serine/threonine transporter SstT (Klebsiella michiganensis M5al)
MATQSPRSTLLRRLAQGSLVKQILIGLVLGVLLATVSKPAAVAVGLLGTLFVGALKAVAP
VLVLMLVMASIANHQQGQKTSIRPILFLYLLGTFAAALTAVVFSFIFPSTLHLNAAAESI
TPPSGIVEVLRGLLMSMVSNPIDALLNANYIGILVWAVGLGFALRHGNETTKNLINDVSH
AVTFIVKVVIRFAPLGIFGLVASTLATTGFETLWGYAQLLLVLVGCMLLVALVINPLLVF
WKIRRNPYPLVLLCLRESGVYAFFTRSSAANIPVNMALSEKLNLDRDTYSVSIPLGATIN
MAGAAITITVLTLAAVHTLNVPVDLPTALLLSVVASLCACGASGVAGGSLLLIPLACNMF
GIPNDVAMQVVAVGFIIGVLQDSCETALNSSTDVLFTAAACIAEDEQIAKNALRN