Protein Info for BWI76_RS24685 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 364 to 388 (25 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 11 to 441 (431 residues), 414.9 bits, see alignment E=1.7e-128 PF13347: MFS_2" amino acids 13 to 434 (422 residues), 341.8 bits, see alignment E=4.9e-106 PF07690: MFS_1" amino acids 23 to 380 (358 residues), 50.1 bits, see alignment E=2e-17

Best Hits

Swiss-Prot: 47% identical to YAGG_ECOLI: Putative glycoside/cation symporter YagG (yagG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to kpe:KPK_0600)

Predicted SEED Role

"Xyloside transporter XynT" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9Z3 at UniProt or InterPro

Protein Sequence (447 amino acids)

>BWI76_RS24685 MFS transporter (Klebsiella michiganensis M5al)
MNTVRISIKEKFSYGLGDTGCNLVWQTVMLFMAWFYTDVFGLSPAHMGTMFLAVRVLDAV
TDVLMGAVADRTRTKYGQFRPYILWFAIPFGVLCCLTFYTPDFGYTGKLIYAYVSYTLLS
LVYTAINVPYCAMINNISNDSRERVSLQSWRFALSTLGGLIVSLTALPLVAWLGQGNVQN
GYFYTMIVMGCLSIILFFICFGLTKERYTKDIAVNNQSSILDDLKTLIANKDWRILFALN
VVNLIAVLFKGGTTLYYVNNIMGRADLGSLLLTTTLASGVLGAMLSPFIFKNIDKVRGFK
ISMAIEAALLIGMYFVPAGNVAAIFALVIIINIIQLAATPLQWSMLSDIIDAEEKRSGKK
LSGIVFSTNLFAIKLGIAIGGALVGYMLAWGDYVGGAAQQTDSALQMIKLLFTVFPGVLV
ALLVVIMSKYSLDDKRLSRLAQDDLPA