Protein Info for BWI76_RS24680 in Klebsiella michiganensis M5al

Annotation: 23S rRNA (guanine(1835)-N(2))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF05175: MTS" amino acids 197 to 368 (172 residues), 187.7 bits, see alignment E=3.3e-59 PF06325: PrmA" amino acids 227 to 303 (77 residues), 25.5 bits, see alignment E=2.1e-09 PF13847: Methyltransf_31" amino acids 230 to 337 (108 residues), 27.6 bits, see alignment E=5.8e-10 PF13649: Methyltransf_25" amino acids 230 to 332 (103 residues), 30.5 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 93% identical to RLMG_KLEP7: Ribosomal RNA large subunit methyltransferase G (rlmG) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K11391, ribosomal RNA large subunit methyltransferase G [EC: 2.1.1.174] (inferred from 92% identity to kva:Kvar_0589)

MetaCyc: 70% identical to 23S rRNA m2G1835 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11635 [EC: 2.1.1.174]

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.174

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9Q3 at UniProt or InterPro

Protein Sequence (376 amino acids)

>BWI76_RS24680 23S rRNA (guanine(1835)-N(2))-methyltransferase (Klebsiella michiganensis M5al)
MSQVELNGELFTLERFPPNAEEEALQAWEAADEYLLQQVNDVDGLTLIFNDSFGALGCAL
AERNPVSINDSYISELATRYNLRMNGIDEESVRFQDPLSELPAAPALVLIKVPKQLALLE
QQLRALREVVTPETRIVAAAKARDVHNSTLALFEKILGTTTTSLAWKKARLIFCTFTAPE
VADAPQTYSWQLDGTPWTIHNHANVFARSGLDIGARFFLEHLPANIEGEIADLGCGNGVI
GLKALALNPDARVMFTDESYMAVASSRLNVETNLPDDIERCEFVVNNALSDIEPDRFAAI
LCNPPFHQQHAITDHIAWQMFNDARRSLKYGGELYVVGNRHLDYFRKLKRAFGNCTTIAT
NNKFVVLKATKVRKQR