Protein Info for BWI76_RS24655 in Klebsiella michiganensis M5al

Annotation: autoinducer 2 ABC transporter permease LsrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 67 to 110 (44 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 243 to 271 (29 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 38 to 300 (263 residues), 139.9 bits, see alignment E=4.6e-45

Best Hits

Swiss-Prot: 95% identical to LSRC_KLEP7: Autoinducer 2 import system permease protein LsrC (lsrC) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K10556, AI-2 transport system permease protein (inferred from 95% identity to kpn:KPN_03506)

MetaCyc: 64% identical to Autoinducer-2 ABC transporter membrane subunit LsrC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Autoinducer 2 (AI-2) ABC transport system, membrane channel protein LsrC" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9Q2 at UniProt or InterPro

Protein Sequence (344 amino acids)

>BWI76_RS24655 autoinducer 2 ABC transporter permease LsrC (Klebsiella michiganensis M5al)
MKTLLKNRELSAFLAIVVLFAGLVALNPAYFSLQTLGMIFASSQILCLLALGATLVMLTR
NIDVSVGSTVGLSAIAVGVALNSGYGLMTAIAFALAIGALAGAFNGLLVVGLRIPAIVAT
LGTLGLYRGVMLLWTGGKWIEGLPNSLKALSEPAFIGISPLGWLVLALLLAGGGILSRTA
FGRDFYAVGDNLAAARQLGVAVNRTRMLAFTLNGMLAACAGIVFAAQIGFVPNQTGSGLE
MKAIAACVLGGISLLGGTGTLLGAFLGAFFLTQIDTVLVLFRLPAWWNDFIAGLVLLGVL
VLDGRLRQALARHQRALKYSRFQPGNKGGKRVAPFPERKNKEVA