Protein Info for BWI76_RS24615 in Klebsiella michiganensis M5al

Annotation: siderophore-interacting protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF08021: FAD_binding_9" amino acids 23 to 134 (112 residues), 105.8 bits, see alignment E=1.7e-34 PF04954: SIP" amino acids 142 to 256 (115 residues), 80.8 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 71% identical to YQJH_ECOLI: NADPH-dependent ferric-chelate reductase (yqjH) from Escherichia coli (strain K12)

KEGG orthology group: K07229, (no description) (inferred from 87% identity to kpn:KPN_03499)

MetaCyc: 71% identical to NADPH-dependent ferric-chelate reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6555 [EC: 1.16.1.9]; 1.16.1.9 [EC: 1.16.1.9]; 1.16.1.9 [EC: 1.16.1.9]

Predicted SEED Role

"iron-chelator utilization protein" in subsystem Ton and Tol transport systems

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9W1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>BWI76_RS24615 siderophore-interacting protein (Klebsiella michiganensis M5al)
MTKANNPKYPQRVRNELRFRELTVQRVERIGHAFQRIVLGGEALDGFVSQGFDDHTKLFF
PEAGAAFTPPVVTDEGINWGEGVRPATRDYTPLYDAGRHELAYDFFIHDGGIASRWALTA
QAGDKLVIGGPRGSLVVPEDYAWQLYVTDESGMPALRRRLLGLQQLPTPPQVTAIVTIGD
ASYQDYLADLDGFNIEWVVGHNPAAVAERLAQVVIPADDYFIWLTGEGAAVKSLLARFEG
EEIDPQLVRSQAYWHSK