Protein Info for BWI76_RS24555 in Klebsiella michiganensis M5al

Annotation: RNA polymerase sigma factor RpoD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 PF03979: Sigma70_r1_1" amino acids 5 to 81 (77 residues), 104.3 bits, see alignment E=7.9e-34 PF00140: Sigma70_r1_2" amino acids 98 to 128 (31 residues), 46 bits, see alignment (E = 1.2e-15) PF04546: Sigma70_ner" amino acids 139 to 349 (211 residues), 251.1 bits, see alignment E=3.3e-78 TIGR02393: RNA polymerase sigma factor RpoD" amino acids 376 to 612 (237 residues), 399.2 bits, see alignment E=6.2e-124 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 376 to 601 (226 residues), 128.7 bits, see alignment E=1.6e-41 PF04542: Sigma70_r2" amino acids 380 to 450 (71 residues), 82.9 bits, see alignment E=3.3e-27 PF04539: Sigma70_r3" amino acids 459 to 534 (76 residues), 99.8 bits, see alignment E=2.3e-32 PF04545: Sigma70_r4" amino acids 548 to 601 (54 residues), 65.1 bits, see alignment 1e-21

Best Hits

Swiss-Prot: 95% identical to RPOD_SALTI: RNA polymerase sigma factor RpoD (rpoD) from Salmonella typhi

KEGG orthology group: K03086, RNA polymerase primary sigma factor (inferred from 98% identity to cko:CKO_04466)

MetaCyc: 94% identical to RNA polymerase sigma factor RpoD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoD" in subsystem Flagellum or Macromolecular synthesis operon or Transcription factors cyanobacterial RpoD-like sigma factors or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9V2 at UniProt or InterPro

Protein Sequence (614 amino acids)

>BWI76_RS24555 RNA polymerase sigma factor RpoD (Klebsiella michiganensis M5al)
MEQNPQSQLKLLVQRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAP
DADDLLLAETNNNTDEDAEEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEID
IAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTA
THVGSELSQEEMDDDEDEDEEEDDDSSDDDNSIDPELAREKFAELRTQYELTRDTIKAKG
RSHAAAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERIIMKLCVEQCKMPK
KNFITLFTGNETSETWFNAAIAMNKPWSEKLLDVKEDVQRGLMKLQQIEQETGLTIEQVK
DINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKF
EYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPT
PEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDNTLELPLDSATTES
LRAATHDVLAGLTAREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLR
HPSRSEVLRSFLDD