Protein Info for BWI76_RS24530 in Klebsiella michiganensis M5al

Annotation: cytosine/purines uracil thiamine allantoin permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 transmembrane" amino acids 41 to 66 (26 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 256 to 285 (30 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details amino acids 377 to 401 (25 residues), see Phobius details amino acids 423 to 447 (25 residues), see Phobius details amino acids 453 to 473 (21 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 36 to 445 (410 residues), 37.1 bits, see alignment E=9.1e-14

Best Hits

KEGG orthology group: None (inferred from 93% identity to kpu:KP1_4762)

Predicted SEED Role

"PROBABLE CONSERVED TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA27 at UniProt or InterPro

Protein Sequence (535 amino acids)

>BWI76_RS24530 cytosine/purines uracil thiamine allantoin permease (Klebsiella michiganensis M5al)
MSSLDIKTDLPAQTSASGSKETLEDYTLRYAPLSFRRWGPGVVAVTALGGIAYLADFSIG
ASIGMAWGTTNAIYAILLAALVIFLTGIPLAITAARYNIDLDLITRSAGFGYFGSVITSI
IFAGFTFIFFALEGSIMAQGLLVGLGIPLWMGYLIATLMVLPLVVYGMKALTRLQVWTTP
LWLVLMVVPVAWLIAKDPDLVDGFMNFAGKNNAATVDLTAIMLGAGVCLSLIMQIGEQID
YLRFMPPKTAENSKSWWLAVFSAGPGWVVLGAIKQIIGAFLGFYLLTRFPAVHNTEPVQQ
FVSVFDNLVPGWLALTLAVVLVVISQIKINVTNAYSGSLAWTSAWTRTTKRYPGRIIFVI
VNLTIALALMEGDMFSALAWILGFYSNFAIAWVVVVATDITVNKGLLKLAPAQPEYRRGM
IYNVNPVGVVAFALAAGLSISAFFGLLGETLAPFSPLIALAVAFVMTPVMGIATRGRYYI
KQRDDGIAEPRYDTQGNASITVYRCLSCREEYERPDVMHSHKHQGAICSLCKSME