Protein Info for BWI76_RS24520 in Klebsiella michiganensis M5al

Annotation: urease accessory protein UreF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF01730: UreF" amino acids 38 to 181 (144 residues), 118.6 bits, see alignment E=1.5e-38

Best Hits

Swiss-Prot: 88% identical to UREF_ECO5E: Urease accessory protein UreF (ureF) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K03188, urease accessory protein (inferred from 88% identity to eoj:ECO26_1284)

Predicted SEED Role

"Urease accessory protein UreF" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA21 at UniProt or InterPro

Protein Sequence (224 amino acids)

>BWI76_RS24520 urease accessory protein UreF (Klebsiella michiganensis M5al)
MPTPEKRLRLMQLASSSLPVGGYSWSQGLEWAVEAGWVADTAAFERWQLRQMEQSFFTVD
LPLFARLYRACEAGDLACARRWTAYLLACRETRELRDEERNRGAAFTRLLADWQPDCPPE
WRKLCQQSQLTGMAWLGVRWQIAIPDLALSLGYSWIESAVMAGVKLVPFGQQAAQQLILR
LCDRYAADMDSALAAPDDALGSATPLAAIASARHETQYSRLFRS