Protein Info for BWI76_RS24500 in Klebsiella michiganensis M5al

Annotation: urease subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00193: urease, gamma subunit
  • amino acids 1 to 99 (99 residues), 173.1 bits, E=6.4e-56
• PF00547: Urease_gamma
  • amino acids 1 to 99 (99 residues), 159.9 bits, E=8.9e-52

Best Hits

Swiss-Prot: 97% identical to URE3_KLEAE: Urease subunit gamma (ureA) from Klebsiella aerogenes

KEGG orthology group: K01430, urease subunit gamma [EC: 3.5.1.5] (inferred from 92% identity to ent:Ent638_3464)

MetaCyc: 76% identical to urease gamma subunit (Sinorhizobium meliloti Rm2011)
Urease. [EC: 3.5.1.5]

Predicted SEED Role

"Urease gamma subunit (EC 3.5.1.5)" in subsystem Urea decomposition (EC 3.5.1.5)

MetaCyc Pathways

• superpathway of allantoin degradation in plants (7/8 steps found)
• urea degradation II (1/1 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Purine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.5

Use Curated BLAST to search for 3.5.1.5

Sequence Analysis Tools

See A0A285B9U2 at UniProt or InterPro

Protein Sequence (100 amino acids)

>BWI76_RS24500 urease subunit gamma (Klebsiella michiganensis M5al)
MELTPREKDKLLLFTAALVAERRLARGLKLNYPESVALISAFIMEGARDGKSVAELMEEG
RHVLSRDQVMEGVPEMIPDIQVEATFPDGSKLVTVHNPII