Protein Info for BWI76_RS24490 in Klebsiella michiganensis M5al

Annotation: glycerol-3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase
  • amino acids 1 to 194 (194 residues), 269.6 bits, E=8.1e-85
• PF02660: G3P_acyltransf
  • amino acids 11 to 184 (174 residues), 179.8 bits, E=2.3e-57

Best Hits

Swiss-Prot: 96% identical to PLSY_KLEP3: Glycerol-3-phosphate acyltransferase (plsY) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 98% identity to eae:EAE_03665)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (11/12 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

Sequence Analysis Tools

See A0A285B9T6 at UniProt or InterPro

Protein Sequence (206 amino acids)

>BWI76_RS24490 glycerol-3-phosphate acyltransferase (Klebsiella michiganensis M5al)
MSAIAPGLVILAYLCGSISSAILVCRLAGLPDPRDSGSGNPGATNVLRIGGKGAAVAVLI
FDVLKGMLPVWGAWALGLTPFWLGLVAIAACVGHIWPVFFNFRGGKGVATAFGAIAPIGW
DLTGVMAGTWLLTILLSGYSSLGAIVSALIAPFYVWWFKPQYTFPVSMLSCLILLRHHDN
IQRLWRRQETRIWSRFKKKKKAPEQK