Protein Info for BWI76_RS24455 in Klebsiella michiganensis M5al

Annotation: bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 TIGR02198: bifunctional protein RfaE, domain I" amino acids 5 to 312 (308 residues), 424.7 bits, see alignment E=3.2e-131 PF00294: PfkB" amino acids 13 to 305 (293 residues), 181.5 bits, see alignment E=3.7e-57 PF08543: Phos_pyr_kin" amino acids 189 to 288 (100 residues), 30.1 bits, see alignment E=5e-11 TIGR02199: bifunctional protein RfaE, domain II" amino acids 332 to 473 (142 residues), 213.6 bits, see alignment E=1.5e-67 TIGR00125: cytidyltransferase-like domain" amino acids 342 to 408 (67 residues), 61.9 bits, see alignment E=7.6e-21 PF01467: CTP_transf_like" amino acids 344 to 469 (126 residues), 65.6 bits, see alignment E=8.4e-22

Best Hits

Swiss-Prot: 97% identical to HLDE_KLEP3: Bifunctional protein HldE (hldE) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03272, D-beta-D-heptose 7-phosphate kinase / D-beta-D-heptose 1-phosphate adenosyltransferase [EC: 2.7.1.- 2.7.7.-] (inferred from 96% identity to kpu:KP1_4741)

MetaCyc: 93% identical to fused heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-4342 [EC: 2.7.7.70]; RXN0-4341 [EC: 2.7.7.70, 2.7.1.167]

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-, 2.7.1.-, 2.7.7.-

Use Curated BLAST to search for 2.7.-.- or 2.7.1.- or 2.7.1.167 or 2.7.7.- or 2.7.7.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA96 at UniProt or InterPro

Protein Sequence (477 amino acids)

>BWI76_RS24455 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase (Klebsiella michiganensis M5al)
MKVTLPEFERAGVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVENIEERPGGAANVAMNI
ASLGATSRLVGLTGIDDAARALSKALADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLD
FEEGFSGVDPQPMHERIQQALGSIGALVLSDYAKGALTSVQTMIKLARDAGVPVLIDPKG
TDFERYRGATLLTPNLSEFEAVAGKCKDEEEIVERGMKIIADFDLSALLVTRSEQGMTLL
QPGRPPLHMPTQAQEVYDVTGAGDTVIGVLAATLASGNTLEEACYFANAAAGVVVGKLGT
STVSPIELENAVRGRSETGFGVMGEEELKLAVAAARKRGEKVVMTNGVFDILHAGHVSYL
ANARKLGDRLIVAVNSDASTKRLKGESRPVNPLDQRMIVLGALEAVDWVVSFEEDTPQRL
IAGILPDLLVKGGDYKPEQIAGSEEVWANGGEVLVLNFEDGCSTTNIIKKIQKDNKQ