Protein Info for BWI76_RS24410 in Klebsiella michiganensis M5al

Annotation: putative glutathione-like synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF03738: GSP_synth" amino acids 12 to 384 (373 residues), 534.4 bits, see alignment E=8.3e-165

Best Hits

Swiss-Prot: 89% identical to YGIC_ECOLI: Putative acid--amine ligase YgiC (ygiC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_03605)

MetaCyc: 89% identical to peptide--spermidine ligase YgiC (Escherichia coli K-12 substr. MG1655)
6.3.1.-

Predicted SEED Role

"Similarity with glutathionylspermidine synthase (EC 6.3.1.8), group 1" in subsystem Glutathionylspermidine and Trypanothione (EC 6.3.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.8

Use Curated BLAST to search for 6.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9K7 at UniProt or InterPro

Protein Sequence (386 amino acids)

>BWI76_RS24410 putative glutathione-like synthetase (Klebsiella michiganensis M5al)
MERISITERPDWREKATEYGFNFHTMYGEPYWSEEAYYKLTLAQVEKLEDVTAELHQMCL
QAVEKVVASDELMAKFRIPKHTWGFVRQSWKTHQPSLYSRLDLAWDGVGEPKLLENNADT
PTSLYEAAFFQWIWMEDQLNAGQLPAGSDQFNSLQEKLIDRFGELREQFGFQLLHMACCR
DTIEDRGTVQYLQDCAAEAGVATEFLYIEDIGLGEKGQFTDLQDQVIGNLFKLYPWEYML
REVFSTKLEDAGVRWLEPAWKSIISNKALLPLLWEMFPNHPNLLAAYFSEDAHPEMDKYV
IKPIFSREGANVSIMENGKVLEAVEGPYGEEGTIVQEFYPLPKFGDSYTLIGSWLINDQP
AGIGIREDRALITQDLSRFYPHIFVE