Protein Info for BWI76_RS24380 in Klebsiella michiganensis M5al

Annotation: esterase YqiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF05728: UPF0227" amino acids 4 to 188 (185 residues), 241.5 bits, see alignment E=3.3e-76

Best Hits

Swiss-Prot: 84% identical to YQIA_SHIFL: Esterase YqiA (yqiA) from Shigella flexneri

KEGG orthology group: None (inferred from 93% identity to eae:EAE_03575)

Predicted SEED Role

"Putative esterase, FIGfam005057"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9Z5 at UniProt or InterPro

Protein Sequence (191 amino acids)

>BWI76_RS24380 esterase YqiA (Klebsiella michiganensis M5al)
MSTLLYLHGFNSSPRSAKATTLKEWLARTYPDISMVIPELPVYPAQAAEYLEAIVLEHGG
EPLGVVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLNNFLGPNENPYTGQQYVLESR
HIYDLKVMQIDPLEAPDLIWLLQQTGDEVLDYRQAVDYFASCRQTVEEGGNHAFVGFEDH
FTQIIDFLGLR