Protein Info for BWI76_RS24295 in Klebsiella michiganensis M5al

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 167 to 184 (18 residues), see Phobius details PF06719: AraC_N" amino acids 28 to 178 (151 residues), 139.8 bits, see alignment E=8.1e-45 PF00165: HTH_AraC" amino acids 200 to 241 (42 residues), 36.6 bits, see alignment 5.4e-13 amino acids 262 to 288 (27 residues), 32.4 bits, see alignment (E = 1.2e-11) PF12833: HTH_18" amino acids 213 to 288 (76 residues), 81.2 bits, see alignment E=8.4e-27

Best Hits

Swiss-Prot: 88% identical to YQHC_ECOLI: Uncharacterized HTH-type transcriptional regulator YqhC (yqhC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_03490)

Predicted SEED Role

"Hypothetical transcriptional regulator YqhC" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9D9 at UniProt or InterPro

Protein Sequence (299 amino acids)

>BWI76_RS24295 AraC family transcriptional regulator (Klebsiella michiganensis M5al)
MNRAEICQLLTHKVNQLKDKEEMLNGLLPDIRLLYGTQPGTRTPVMYQPGIVFLFSGHKI
GYINERTFRYDTNEYLLLTVPLPFECETFATPEVPLAGIRLNVDILQLQELLMDIGEDEQ
FQPSMASSGINSAVLSEEILCAAERLLDVMERPLDARILGKQIIREILYHVLTGPCGGAL
LALVSRQTHFSLISRVLKRIESQYTENLSVDQLAAEANMSVSAFHHNFKSVTSTSPLQYL
KTYRLHKARMLMIHDGMKASAAAMRVGYESASQFSREFKRYFGMTPGEDAARIRTIQGM