Protein Info for BWI76_RS24150 in Klebsiella michiganensis M5al

Annotation: tRNA (guanosine(46)-N7)-methyltransferase TrmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR00091: tRNA (guanine-N(7)-)-methyltransferase" amino acids 50 to 238 (189 residues), 246.7 bits, see alignment E=5.8e-78 PF02390: Methyltransf_4" amino acids 64 to 233 (170 residues), 215 bits, see alignment E=2.6e-68

Best Hits

Swiss-Prot: 96% identical to TRMB_KLEP7: tRNA (guanine-N(7)-)-methyltransferase (trmB) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 98% identity to eae:EAE_03190)

MetaCyc: 90% identical to tRNA m7G46 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (guanine-N(7)-)-methyltransferase. [EC: 2.1.1.33]

Predicted SEED Role

"tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33)" (EC 2.1.1.33)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9B9 at UniProt or InterPro

Protein Sequence (239 amino acids)

>BWI76_RS24150 tRNA (guanosine(46)-N7)-methyltransferase TrmB (Klebsiella michiganensis M5al)
MKNDVISPEFDENGRPLRRIRSFVRRQGRLTKGQQHALDTIWPVMGVEFNEAPLDFAALF
GREAPVTLEIGFGMGASLVAMAKEKPQQNFLGIEVHSPGVGACLASAEEEGVQNLRVMCH
DAVEVLHTMIPDNSLSMVQLFFPDPWHKARHNKRRIVQPPFAELVKSKLKLGGVFHMATD
WEQYAEHMLEVMSSLEGYRNRSESNDYVPRPESRPVTKFEQRGHRLGHGVWDLMFERVK