Protein Info for BWI76_RS24135 in Klebsiella michiganensis M5al

Annotation: c4-dicarboxylate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 6 to 39 (34 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 274 to 298 (25 residues), see Phobius details amino acids 319 to 350 (32 residues), see Phobius details amino acids 363 to 390 (28 residues), see Phobius details amino acids 405 to 427 (23 residues), see Phobius details PF06808: DctM" amino acids 10 to 422 (413 residues), 401.4 bits, see alignment E=2.2e-124 TIGR00786: TRAP transporter, DctM subunit" amino acids 20 to 427 (408 residues), 466.6 bits, see alignment E=3.1e-144

Best Hits

Swiss-Prot: 61% identical to YGIK_SALTY: Uncharacterized protein YgiK (ygiK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 94% identity to sfx:S3155)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9P9 at UniProt or InterPro

Protein Sequence (433 amino acids)

>BWI76_RS24135 c4-dicarboxylate permease (Klebsiella michiganensis M5al)
MDSYIALMLFGSFFILVFIGVPISFSIGIATVGSMLLMFPWDIAVITVSQRLANGLDNFA
LLAIPFFIFAGTLMNSGGIAIRLINLAQVMVGRVPGSLGHVNVLANMMFGSISGSAVAAA
AAVGGTLNPIQTRKGYDPAFSTAVNVSSCITGLLIPPSNVLIVFSLTAGGVSVASLFMAG
YLPGILMGLAIMVVCAIIAKRRGYPVSERPTCAQAAKAFFDALPSLLLVIIVMGGILGGI
FTATEASAIAVVYTFILSVLIYREVKWRDLPKLILESVVMTSIVLLLIGFSVGMSWAMTN
ADIPYMISDALMGISENPVVILLLINIVLLIVGIFMDMTPAVLIFTPIFLPIAQDLGMDP
VHFGIMMVANLCIGLLTPPVGSALFVGCSISGVKIQQLIKPLLPFYAALLIALMMIVYIP
QISLFIPQLLGLM