Protein Info for BWI76_RS24130 in Klebsiella michiganensis M5al

Annotation: small integral C4-dicarboxylate membrane transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details PF04290: DctQ" amino acids 25 to 156 (132 residues), 112.1 bits, see alignment E=9.1e-37

Best Hits

KEGG orthology group: None (inferred from 77% identity to eoh:ECO103_3537)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9K1 at UniProt or InterPro

Protein Sequence (167 amino acids)

>BWI76_RS24130 small integral C4-dicarboxylate membrane transporter (Klebsiella michiganensis M5al)
MILNRIKLAVDRAIAAFSVAVMIALVVCVVWQVFSRYVLNQPSTLTDELARFLMIWVGLL
GAAYTVGAQRHLAIDLLAMTLPPRRQALLSVIINLLIFIFAGSVIVTGGVKLIEKTLSTS
QVSAAMQIPMGYVYLILPLTGIIMMFYTLCFISNGLKNMKNEEAGAN