Protein Info for BWI76_RS24105 in Klebsiella michiganensis M5al

Annotation: resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 89 to 115 (27 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details PF02325: YGGT" amino acids 10 to 78 (69 residues), 72.6 bits, see alignment E=1.5e-24 amino acids 101 to 167 (67 residues), 64.7 bits, see alignment E=4.1e-22

Best Hits

Swiss-Prot: 85% identical to YGGT_ECOL6: Uncharacterized protein YggT (yggT) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02221, YggT family protein (inferred from 95% identity to kpu:KP1_4662)

Predicted SEED Role

"Integral membrane protein YggT, involved in response to extracytoplasmic stress (osmotic shock)" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9H5 at UniProt or InterPro

Protein Sequence (188 amino acids)

>BWI76_RS24105 resistance protein (Klebsiella michiganensis M5al)
MKTLTFLLSTVIELYTMVVLLRVWMQWARCDFYNPFSQFVVKATQPVVGPLRRIIPAMGP
LDSASLLVAFILCVVKAIVLFMVVTFQPIIWISALLILIKTVGSLIFWVLLLMAIMSWVS
QGRSPVEFVLMQLADPLLRPIRRLLPSMGGIDFSPMVLVLLLYVINMGIAELLQATGNVL
LPGLWMAL