Protein Info for BWI76_RS24090 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator CsgD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF21155: VpsT-like_REC" amino acids 17 to 130 (114 residues), 40 bits, see alignment E=3.9e-14 PF00196: GerE" amino acids 156 to 211 (56 residues), 72.3 bits, see alignment E=2e-24

Best Hits

KEGG orthology group: K04333, LuxR family transcriptional regulator, csgAB operon transcriptional regulatory protein (inferred from 92% identity to kpu:KP1_4659)

Predicted SEED Role

"Transcriptional regulator CsgD for 2nd curli operon" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9A1 at UniProt or InterPro

Protein Sequence (217 amino acids)

>BWI76_RS24090 transcriptional regulator CsgD (Klebsiella michiganensis M5al)
MINLSENSAFSHQVTFITHPSIQSKAFATWLAERLSASVILQNINKPLAQRLLKDSVILF
DIAVSNKKLNSVWRDIIRMQADNPRLLIINSAQKYELYEMAQWPALYGVFRHDDDESRLI
EGVKAVLNGEQTAELSVMHPAMYAADHVSAPAENSPLTERECEILNELRCGATNLDIARA
LFISENTVRTHLYNVFRKLSVKNRTQAVSWANEHLRH