Protein Info for BWI76_RS24060 in Klebsiella michiganensis M5al

Annotation: SprT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF10263: SprT-like" amino acids 19 to 110 (92 residues), 78.4 bits, see alignment E=3.7e-26 PF17283: Zn_ribbon_SprT" amino acids 126 to 163 (38 residues), 30.5 bits, see alignment 3e-11

Best Hits

Swiss-Prot: 91% identical to SPRT_KLEP3: Protein SprT (sprT) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K02742, SprT protein (inferred from 91% identity to kpe:KPK_0732)

Predicted SEED Role

"Protein sprT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B963 at UniProt or InterPro

Protein Sequence (166 amino acids)

>BWI76_RS24060 SprT family protein (Klebsiella michiganensis M5al)
MKTPRIPIALQQAVMRSLRENLAKANLKLGRHYPEPALVYQQRGTSAGTAWLEKNEIRLN
PVLLLENQQAFIDEVVPHELAHLLVWKHFGRVAPHGKEWKWMMESVLGVPALRTHRFELD
SVRKNTFPYRCQCQQHQLTVRRHNRVMRGEATYRCVRCGDVLVAEK