Protein Info for BWI76_RS24030 in Klebsiella michiganensis M5al

Annotation: arginine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01273: arginine decarboxylase
  • amino acids 31 to 656 (626 residues), 916.4 bits, E=4.6e-280
• PF02784: Orn_Arg_deC_N
  • amino acids 101 to 367 (267 residues), 204.8 bits, E=2.2e-64
• PF17810: Arg_decarb_HB
  • amino acids 392 to 478 (87 residues), 87.2 bits, E=1.2e-28
• PF17944: Arg_decarbox_C
  • amino acids 606 to 655 (50 residues), 62.5 bits, 6e-21

Best Hits

Swiss-Prot: 95% identical to SPEA_ECO57: Biosynthetic arginine decarboxylase (speA) from Escherichia coli O157:H7

KEGG orthology group: K01585, arginine decarboxylase [EC: 4.1.1.19] (inferred from 95% identity to esc:Entcl_0817)

MetaCyc: 95% identical to biosynthetic arginine decarboxylase (Escherichia coli K-12 substr. MG1655)
Arginine decarboxylase. [EC: 4.1.1.19]

Predicted SEED Role

"Biosynthetic arginine decarboxylase (EC 4.1.1.19)" in subsystem Acid resistance mechanisms or Arginine and Ornithine Degradation or Polyamine Metabolism (EC 4.1.1.19)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• superpathway of L-arginine and L-ornithine degradation (13/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (11/11 steps found)
• superpathway of polyamine biosynthesis I (7/8 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)
• arginine dependent acid resistance (1/1 steps found)
• superpathway of putrescine biosynthesis (3/4 steps found)
• spermidine biosynthesis III (2/4 steps found)
• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (1/3 steps found)
• putrescine biosynthesis II (1/3 steps found)
• superpathway of polyamine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.19

Sequence Analysis Tools

See A0A285B989 at UniProt or InterPro

Protein Sequence (658 amino acids)

>BWI76_RS24030 arginine decarboxylase (Klebsiella michiganensis M5al)
MSDDMSLSSPSSAGDHGVLRSMQEVAMSSQEASKMLRTYNIAWWGNNYYDVNELGHISVC
PDPDVPEARVDLAELVKAREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYGYNGDY
FLVYPIKVNQHRRVIESLIHSGEPLGLEAGSKAELMAVLAHAGMTRSVIVCNGYKDREYI
RLALVGEKMGHKVYLVIEKMSEIAIVLEEAERLNVVPRLGVRARLASQGSGKWQSSGGEK
SKFGLAATQVLQLVEILRSAGHLDSLQLLHFHLGSQMANIRDIATGVRESSRFYVELHKL
GVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNIIWAIGDACEENGLPHPTVITE
SGRAVTAHHTVLVSNIIGVERNEYTEATPPAEDAARPLQSMWETWLEMQETGNRRSLREW
LHDSQMDLHDIHIGYSSGTFNLQERAWAEQLYLNMCHEVQKQLDPSNRAHRPIIDELQER
MADKIYVNFSLFQSMPDAWGIDQLFPVMPLEGLNMVPERRAVLLDITCDSDGAIDHYVDG
DGIATTMPMPEYDPENPPMLGFFMVGAYQEILGNMHNLFGDTEAVDVFVFPDGSVEVELS
DEGDTVADMLQYVQLDPNTLLTQFRDQVKNTDLDAALQQQFLEEFEAGLYGYTYLEDE