Protein Info for BWI76_RS24010 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00005: ABC_tran" amino acids 19 to 164 (146 residues), 89.8 bits, see alignment E=2.5e-29

Best Hits

KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 77% identity to sei:SPC_3138)

Predicted SEED Role

"ATPase component STY3233 of energizing module of queuosine-regulated ECF transporter" in subsystem ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9W8 at UniProt or InterPro

Protein Sequence (218 amino acids)

>BWI76_RS24010 hypothetical protein (Klebsiella michiganensis M5al)
MLTLNQVTYRWPGAAADCLQNISLNLGENEWLALTGDNGAGKSTLLRVMAGLLPATSGTV
NLLDKPMAHYKNRHRAGMLGVLFQEAENQIFHSKVAEEVAFGLRLQKRSAAEVAQRTAAA
LQLCQLEDVADAHPLDLHTAQRRMVAVACLEAMAPAVLLLDEPSRDFDQHWLTIFEEWLA
VCRKRGTSVVAISHDPAFIQRHFSRMVRLEKGRLLSIS