Protein Info for BWI76_RS23950 in Klebsiella michiganensis M5al

Annotation: succinate CoA transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 PF02550: AcetylCoA_hydro" amino acids 2 to 209 (208 residues), 221.6 bits, see alignment E=1.1e-69 TIGR03458: succinate CoA transferase" amino acids 2 to 486 (485 residues), 747 bits, see alignment E=4.3e-229 PF13336: AcetylCoA_hyd_C" amino acids 313 to 457 (145 residues), 140.4 bits, see alignment E=4.9e-45

Best Hits

Swiss-Prot: 90% identical to SCPC_ECOLI: Propionyl-CoA:succinate CoA transferase (scpC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to esc:Entcl_0834)

MetaCyc: 90% identical to propionyl-CoA:succinate CoA transferase (Escherichia coli K-12 substr. MG1655)
RXN0-268 [EC: 2.8.3.27]

Predicted SEED Role

"Propionyl-CoA:succinyl-CoA transferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B943 at UniProt or InterPro

Protein Sequence (488 amino acids)

>BWI76_RS23950 succinate CoA transferase (Klebsiella michiganensis M5al)
MKRMSADEAAEIIQHDQMVAFSGFTPAGSPKALPAAIARRAGELHQAQQPFQIRLLTGAS
ISAAADDALSAADAVSWRAPYQTASGLRQKINQGKVNFVDLHLSEVAQMVNYGFFGEIDV
AVIEASALAPDGRVWLTSGIGNAPTWLLRAKKVIIELNHYHNPRVAELADIVIPGAPPRR
NSIAIFHTMDRVGSRYVQIDPQKIVAVVETELPDAGNALDKINPVCQQIADNVVTFLLDE
MARGRIPPEFLPLQSGVGNINNAVMARLGENPDIPAFMMYSEVLQESVVHLLESGKITGV
SASSLTVSADALRKIYDNMDFFASRIVLRPQEISNNPEIIRRLGVIALNVGLEFDIYGHA
NSTHVAGVNLMNGIGGSGDFERNAWLSIFMAPSIAKEGKISTIVPMCSHVDHSEHSVKVI
VTEQGIADLRGLSPLQRARVIIDNCAHPLYRDYLHRYLDNAPGGHIHHDLTHAFDLHRNL
LEHGSMLG