Protein Info for BWI76_RS23950 in Klebsiella michiganensis M5al

Annotation: succinate CoA transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03458: succinate CoA transferase
  • amino acids 2 to 486 (485 residues), 747 bits, E=4.3e-229
• PF02550: AcetylCoA_hydro
  • amino acids 2 to 209 (208 residues), 221.6 bits, E=1.1e-69
• PF13336: AcetylCoA_hyd_C
  • amino acids 313 to 457 (145 residues), 140.8 bits, E=3.6e-45

Best Hits

Swiss-Prot: 90% identical to SCPC_ECOLI: Propionyl-CoA:succinate CoA transferase (scpC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to esc:Entcl_0834)

MetaCyc: 90% identical to propionyl-CoA:succinate CoA transferase (Escherichia coli K-12 substr. MG1655)
RXN0-268 [EC: 2.8.3.27]

Predicted SEED Role

"Propionyl-CoA:succinyl-CoA transferase"

MetaCyc Pathways

• conversion of succinate to propanoate (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• pyruvate fermentation to propanoate I (5/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• L-glutamate degradation VIII (to propanoate) (7/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.27

Sequence Analysis Tools

See A0A285B943 at UniProt or InterPro

Protein Sequence (488 amino acids)

>BWI76_RS23950 succinate CoA transferase (Klebsiella michiganensis M5al)
MKRMSADEAAEIIQHDQMVAFSGFTPAGSPKALPAAIARRAGELHQAQQPFQIRLLTGAS
ISAAADDALSAADAVSWRAPYQTASGLRQKINQGKVNFVDLHLSEVAQMVNYGFFGEIDV
AVIEASALAPDGRVWLTSGIGNAPTWLLRAKKVIIELNHYHNPRVAELADIVIPGAPPRR
NSIAIFHTMDRVGSRYVQIDPQKIVAVVETELPDAGNALDKINPVCQQIADNVVTFLLDE
MARGRIPPEFLPLQSGVGNINNAVMARLGENPDIPAFMMYSEVLQESVVHLLESGKITGV
SASSLTVSADALRKIYDNMDFFASRIVLRPQEISNNPEIIRRLGVIALNVGLEFDIYGHA
NSTHVAGVNLMNGIGGSGDFERNAWLSIFMAPSIAKEGKISTIVPMCSHVDHSEHSVKVI
VTEQGIADLRGLSPLQRARVIIDNCAHPLYRDYLHRYLDNAPGGHIHHDLTHAFDLHRNL
LEHGSMLG