Protein Info for BWI76_RS23945 in Klebsiella michiganensis M5al

Annotation: methylmalonyl-CoA decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00378: ECH_1" amino acids 12 to 259 (248 residues), 161.3 bits, see alignment E=2.8e-51 PF16113: ECH_2" amino acids 15 to 195 (181 residues), 75 bits, see alignment E=8.1e-25

Best Hits

Swiss-Prot: 93% identical to SCPB_ECOLI: Methylmalonyl-CoA decarboxylase (scpB) from Escherichia coli (strain K12)

KEGG orthology group: K11264, methylmalonyl-CoA decarboxylase [EC: 4.1.1.41] (inferred from 95% identity to ses:SARI_04583)

MetaCyc: 93% identical to methylmalonyl-CoA decarboxylase (Escherichia coli K-12 substr. MG1655)
4.1.1.M5 [EC: 4.1.1.M5]

Predicted SEED Role

"Methylmalonyl-CoA decarboxylase (EC 4.1.1.41)" (EC 4.1.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.41

Use Curated BLAST to search for 4.1.1.41 or 4.1.1.M5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9E4 at UniProt or InterPro

Protein Sequence (261 amino acids)

>BWI76_RS23945 methylmalonyl-CoA decarboxylase (Klebsiella michiganensis M5al)
MSYQYVNVEIIRKVAVIEFNYSRKLNALSKVFIDDLMQALSDLNRPEIRCVILRAPGGAK
VFSAGHDIHELPGGRRDPLSYDDPLRQITRMIQKYPKPVISMVEGSVWGGAFEMIMSSDL
IIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTALPITAQRALAVGILNH
VVDADELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRAVYDS
EDYQEGMSAFMEKRKPEFVGH