Protein Info for BWI76_RS23925 in Klebsiella michiganensis M5al
Annotation: ribose-5-phosphate isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to RPIA_KLEP7: Ribose-5-phosphate isomerase A (rpiA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 96% identity to ent:Ent638_3333)MetaCyc: 94% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]
Predicted SEED Role
"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)
MetaCyc Pathways
- superpathway of glucose and xylose degradation (17/17 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- pentose phosphate pathway (8/8 steps found)
- Bifidobacterium shunt (13/15 steps found)
- Rubisco shunt (9/10 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
- Calvin-Benson-Bassham cycle (10/13 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- ethene biosynthesis V (engineered) (18/25 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- oxygenic photosynthesis (11/17 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Carbon fixation in photosynthetic organisms
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 5.3.1.6
Use Curated BLAST to search for 5.3.1.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B9K3 at UniProt or InterPro
Protein Sequence (219 amino acids)
>BWI76_RS23925 ribose-5-phosphate isomerase (Klebsiella michiganensis M5al) MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL KSLGITVFDLNSVDRLGIYVDGADEINGHMQMIKGGGAALTREKIIASVADKFICIADAS KQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVFGLEILDAI ALENTINGIPGVVTVGLFANRGADVALIGTADGVKTITK