Protein Info for BWI76_RS23915 in Klebsiella michiganensis M5al

Annotation: 5-formyltetrahydrofolate cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 42 to 59 (18 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details PF01812: 5-FTHF_cyc-lig" amino acids 11 to 192 (182 residues), 154.1 bits, see alignment E=2.1e-49 TIGR02727: 5-formyltetrahydrofolate cyclo-ligase" amino acids 11 to 192 (182 residues), 175.3 bits, see alignment E=5.9e-56

Best Hits

Swiss-Prot: 80% identical to 5FCL_ECO57: 5-formyltetrahydrofolate cyclo-ligase (ygfA) from Escherichia coli O157:H7

KEGG orthology group: K01934, 5-formyltetrahydrofolate cyclo-ligase [EC: 6.3.3.2] (inferred from 85% identity to kpe:KPK_0753)

MetaCyc: 80% identical to putative 5-formyltetrahydrofolate cyclo-ligase (Escherichia coli K-12 substr. MG1655)
5-formyltetrahydrofolate cyclo-ligase. [EC: 6.3.3.2]

Predicted SEED Role

"5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B967 at UniProt or InterPro

Protein Sequence (198 amino acids)

>BWI76_RS23915 5-formyltetrahydrofolate cyclo-ligase (Klebsiella michiganensis M5al)
MTLLSDPPYTRQQIRQQIRLRRRALTPEQQTQFALLAADRMMAYPPVLLAHTVAVFLSFD
GELDTRPLIDQLWRAGKRVYLPVLHPFSPGNLLFLHYHPSSVLVVNRLKIREPKLDVRDV
LPLSQLDVLVTPLVAFDAAGQRLGMGGGFYDRTLQNWRQHRLQPVGYAHDCQQVDALPTE
QWDIPLPAVITPSKTWLW