Protein Info for BWI76_RS23900 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF03695: UPF0149" amino acids 14 to 178 (165 residues), 147.4 bits, see alignment E=2.7e-47 TIGR02292: yecA family protein" amino acids 19 to 168 (150 residues), 44.8 bits, see alignment E=5.5e-16

Best Hits

Swiss-Prot: 93% identical to Y755_KLEP3: UPF0149 protein KPK_0755 (KPK_0755) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K09895, hypothetical protein (inferred from 94% identity to kva:Kvar_0723)

Predicted SEED Role

"FIG001590: Putative conserved exported protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9D2 at UniProt or InterPro

Protein Sequence (194 amino acids)

>BWI76_RS23900 hypothetical protein (Klebsiella michiganensis M5al)
MRMSIQNEMPGYNAVDQLLNQQGVGLTPAEMHGLISGILCGGNKDSSWQPLVHDLTNEGL
AFGHELAQALRNMHSATSDSLEDDGFLFQLYLPDGDEVSVFDRADALAGWVNHFLLGLGV
TQPKLDKVKDETGEAIDDLRNIAQLGYDEDEDQEELEMSLEEIIEYVRVAALLCHDTFSL
QKPTAPEVQKPTLH