Protein Info for BWI76_RS23865 in Klebsiella michiganensis M5al

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00106: adh_short" amino acids 3 to 196 (194 residues), 170 bits, see alignment E=6.6e-54 PF08659: KR" amino acids 4 to 168 (165 residues), 55.9 bits, see alignment E=8.3e-19 PF13561: adh_short_C2" amino acids 11 to 246 (236 residues), 188.6 bits, see alignment E=2.1e-59

Best Hits

Swiss-Prot: 81% identical to YGFF_ECOLI: Uncharacterized oxidoreductase YgfF (ygfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to kpu:KP1_4624)

MetaCyc: 39% identical to lyngbyatoxin A monooxygenase (Moorena producens)
1.14.13.-; 1.14.13.-

Predicted SEED Role

"FIG00553873: hypothetical protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9F6 at UniProt or InterPro

Protein Sequence (247 amino acids)

>BWI76_RS23865 NAD(P)-dependent oxidoreductase (Klebsiella michiganensis M5al)
MTIALVTGGSRGIGKATALLLAQEGYTVAVNYHQNSAAATGVVNEIIASGGKAVALRADV
SDEAQVMAMFASIDRLGEPLSALVNNAGILFTQGTIESLSADRINRVLATNVTGYFLCCR
EAVKRMSHKHGGKGGAIVNVSSAASRLGAPGEYVDYAASKGAVDTLTTGLSLEVAAQGIR
VNGVRPGLIYTDMHASGGEPGRVDRVKSMLPMRRGGQPEEVAQAIVWLLSDKASYVTGSF
LELAGGK