Protein Info for BWI76_RS23860 in Klebsiella michiganensis M5al

Annotation: protein disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF08534: Redoxin" amino acids 36 to 139 (104 residues), 39.8 bits, see alignment E=8.2e-14 PF00578: AhpC-TSA" amino acids 40 to 142 (103 residues), 43.9 bits, see alignment E=4.3e-15 PF13905: Thioredoxin_8" amino acids 57 to 139 (83 residues), 36 bits, see alignment E=1.5e-12

Best Hits

Swiss-Prot: 39% identical to THIX_HAEIN: Thioredoxin-like protein HI_1115 (HI_1115) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 77% identity to kva:Kvar_0731)

Predicted SEED Role

"Membrane protein, suppressor for copper-sensitivity ScsD" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B956 at UniProt or InterPro

Protein Sequence (163 amino acids)

>BWI76_RS23860 protein disulfide oxidoreductase (Klebsiella michiganensis M5al)
MMLNVFRLILTWLLIVAAVSLAVDYLRKPALPQNFSSTPLQTLDGRTVDLAAMSHERPLL
LYVWATWCSVCRYTTPSVAALADDGGNVMTVALRSGDNATLTRWLAHKKTALPTINDASG
QLSQRWEVQVTPTLIVISRGEVKSVTTGWTSGWGMRLRLWMAS