Protein Info for BWI76_RS23845 in Klebsiella michiganensis M5al

Annotation: ASCH domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 84% identical to Y3264_KLEP7: UPF0267 protein KPN78578_32640 (KPN78578_32640) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 87% identity to eae:EAE_02845)

MetaCyc: 80% identical to N4-acetylcytidine amidohydrolase (Escherichia coli K-12 substr. MG1655)
RXN-21270 [EC: 3.5.1.135]

Predicted SEED Role

"RNA-binding domain protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.135

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B923 at UniProt or InterPro

Protein Sequence (103 amino acids)

>BWI76_RS23845 ASCH domain-containing protein (Klebsiella michiganensis M5al)
MQPNNITFFQRFQDDILAGRKTITIRDAAESHFKAGDVLRVGRYEDDGYFCTIRVVATST
VTLDTLNERHAQQENMTLPQLREVIAEIYPEEKLFYVIEFERL