Protein Info for BWI76_RS23775 in Klebsiella michiganensis M5al

Annotation: 3,4-dihydroxybenzoate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF20695: UbiD_N" amino acids 26 to 103 (78 residues), 44.9 bits, see alignment E=1.6e-15 PF01977: UbiD" amino acids 119 to 328 (210 residues), 194.8 bits, see alignment E=1.5e-61 PF20696: UbiD_C" amino acids 335 to 469 (135 residues), 105.8 bits, see alignment E=2.4e-34

Best Hits

Swiss-Prot: 54% identical to LPDC_LACPL: Gallate decarboxylase (lpdC) from Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 81% identity to rah:Rahaq_4843)

MetaCyc: 62% identical to protocatechuate decarboxylase catalytic subunit (Klebsiella pneumoniae pneumoniae)
Protocatechuate decarboxylase. [EC: 4.1.1.63]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9H8 at UniProt or InterPro

Protein Sequence (497 amino acids)

>BWI76_RS23775 3,4-dihydroxybenzoate decarboxylase (Klebsiella michiganensis M5al)
MANSDNKTPSSVHDLRSALELLKTLPGEYVETDTEVDPHAELSGVYRYVGAGGTCQRPTR
KNGPVMVFNKIKGFENISVAIGLNGSRQRVSHFLQCEPAKLGHLLKDSVEKAIAPVMTQG
TAVCQEVIHLASDADFDLRKLLPAPTNTEEDAGPYITMGLCYASDPETHESDITIHRLCV
QSRDELSMWLTPGRHIDAFRMKAEAAGQPLPISISIGVDPAIEIAACFEPPTTPLGFNEL
SIAGALRGKAVEMTQCKTINEKAIAHAEIVIEGELLPHARVREDQNTDTGRAMPEFPGYT
GEAKEAIPVIKVKAVTHRINPIWRTTVGPGEEHVNMAGIPTEASILDMVERAMPGKLLNV
FAHSAGGGKLLAVLQFKKSSPADEGRQRQAALLAFSAFPELKHVILVDEDVDIFDSDDVL
WAMQTRYQGDVDTITIPGVRCHPLDPSQVPEYSPSILQQGMSCKTIFDCTVPFHLKHNFQ
RSRFKEVDVKRFLADFE