Protein Info for BWI76_RS23770 in Klebsiella michiganensis M5al

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00126: HTH_1" amino acids 3 to 61 (59 residues), 78.2 bits, see alignment E=3.7e-26 PF03466: LysR_substrate" amino acids 89 to 250 (162 residues), 65.4 bits, see alignment E=4.9e-22

Best Hits

KEGG orthology group: None (inferred from 44% identity to rah:Rahaq_4844)

Predicted SEED Role

"LysR family transcriptional regulator YnfL" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9D5 at UniProt or InterPro

Protein Sequence (298 amino acids)

>BWI76_RS23770 LysR family transcriptional regulator (Klebsiella michiganensis M5al)
MDLKRLRYFCRVVEQGSVSQAAKSLNMAQPPLSKRIQELEEELQVSLFVRRGNRIEPTEA
GFFLYRKACEILRQVEDTARETTDIAHKNRTELRIGLTHLYQNYFKALLMEVYRRHPDTS
INISVTDSSHLETLLTEGAIDLALIQRPYRSEGFDYVSFDPIKLVAVINKKCLPEPPSNP
YSYTSLAALPLVLLHRAKDSGTYEMLMDLFRKSGVNAKVIMHITQPGVILDWLDSGLEAA
TLLPSSEVDADKLSHCYVVDVFPSPQIFYPALVKLPSMPYLPALMDIITHGYPFNTSV