Protein Info for BWI76_RS23765 in Klebsiella michiganensis M5al

Annotation: peptidase M23

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01476: LysM" amino acids 30 to 72 (43 residues), 61.4 bits, see alignment 6.1e-21 PF01551: Peptidase_M23" amino acids 135 to 228 (94 residues), 105.4 bits, see alignment E=1.5e-34

Best Hits

Swiss-Prot: 73% identical to YGER_ECOLI: Uncharacterized lipoprotein YgeR (ygeR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to eae:EAE_02785)

MetaCyc: 73% identical to amidase activator (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B937 at UniProt or InterPro

Protein Sequence (241 amino acids)

>BWI76_RS23765 peptidase M23 (Klebsiella michiganensis M5al)
MRKRFVIAIMLLSSLIVAGCSSSSDSGSTYTVKRGDTLYAISRSTGTSVRDLARLNNISP
PYTIEVGQKLKLNSGSGTTAKAGASGKKSSVKRTAAVTPSSAVPQSSWPPVGQRCWRWPT
SGKVVLPYSTSDGGNKGIDIAGKRGQPVYAAGAGKVVYVGNQLRGYGNLIMIKHNEDYIS
AYAHNDKLMVNNGQSVKIGQQIATMGSSDADSVRLHFQIRYRATAIDPLRYLPPQGSKPK
C