Protein Info for BWI76_RS23705 in Klebsiella michiganensis M5al

Updated annotation (from data): 2-deoxy-D-ribonyl-CoA 3-dehydrogenase
Rationale: Important for deoxyribonate utilization. Although the closest characterized homolog is a 3-oxoacyl-CoA reductase (fabG or P0A0H9), an ACP-attached substrate is normally part of biosynthesis, which is difficult to reconcile with this gene's mutant phenotype or its presence in the deoxyribonate utilization cluster.
Original annotation: 3-oxoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 6 to 195 (190 residues), 210.5 bits, E=3.6e-66
• PF08659: KR
  • amino acids 7 to 159 (153 residues), 69.9 bits, E=5.3e-23
• PF01370: Epimerase
  • amino acids 9 to 150 (142 residues), 30.2 bits, E=6.2e-11
• PF13561: adh_short_C2
  • amino acids 12 to 242 (231 residues), 222.5 bits, E=1.2e-69

Best Hits

Swiss-Prot: 45% identical to FABG_STAAC: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus aureus (strain COL)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 96% identity to kpn:KPN_01694)

MetaCyc: 43% identical to 3-oxoacyl-[acyl-carrier-protein] reductase (Bacillus subtilis subtilis 168)
3-oxoacyl-[acyl-carrier-protein] reductase. [EC: 1.1.1.100]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (20/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (16/16 steps found)
• biotin biosynthesis I (15/15 steps found)
• 8-amino-7-oxononanoate biosynthesis I (11/11 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See A0A285B994 at UniProt or InterPro

Protein Sequence (244 amino acids)

>BWI76_RS23705 2-deoxy-D-ribonyl-CoA 3-dehydrogenase (Klebsiella michiganensis M5al)
MKLASKTAIVTGAARGIGFGIAQVLAREGARVIIADRDAHGEAAAASLRESGAQALFISC
NIGDKAQVEALFSQAEEAFGAVDIVVNNAGINRDAMLHKLSEADWDTVIDVNLKGTFLCM
QQAAIRMRERGAGRIINIASASWLGNVGQTNYSASKAGVVGMTKTACRELAKKGVTVNAI
CPGFIDTDMTRGVPENVWQIMINKIPAGYAGEAKDVGECVAFLASDGARYINGEVINVGG
GMVL