Protein Info for BWI76_RS23705 in Klebsiella michiganensis M5al

Updated annotation (from data): 2-deoxy-D-ribonyl-CoA 3-dehydrogenase
Rationale: Important for deoxyribonate utilization. Although the closest characterized homolog is a 3-oxoacyl-CoA reductase (fabG or P0A0H9), an ACP-attached substrate is normally part of biosynthesis, which is difficult to reconcile with this gene's mutant phenotype or its presence in the deoxyribonate utilization cluster.
Original annotation: 3-oxoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF23441: SDR" amino acids 2 to 242 (241 residues), 35.5 bits, see alignment E=1.9e-12 PF00106: adh_short" amino acids 6 to 195 (190 residues), 210.5 bits, see alignment E=4.5e-66 PF08659: KR" amino acids 7 to 163 (157 residues), 70.7 bits, see alignment E=3.9e-23 PF01370: Epimerase" amino acids 9 to 150 (142 residues), 30.2 bits, see alignment E=7.7e-11 PF13561: adh_short_C2" amino acids 12 to 242 (231 residues), 222.8 bits, see alignment E=1.2e-69

Best Hits

Swiss-Prot: 45% identical to FABG_STAAC: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus aureus (strain COL)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 96% identity to kpn:KPN_01694)

MetaCyc: 43% identical to 3-oxoacyl-[acyl-carrier-protein] reductase (Bacillus subtilis subtilis 168)
3-oxoacyl-[acyl-carrier-protein] reductase. [EC: 1.1.1.100]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B994 at UniProt or InterPro

Protein Sequence (244 amino acids)

>BWI76_RS23705 2-deoxy-D-ribonyl-CoA 3-dehydrogenase (Klebsiella michiganensis M5al)
MKLASKTAIVTGAARGIGFGIAQVLAREGARVIIADRDAHGEAAAASLRESGAQALFISC
NIGDKAQVEALFSQAEEAFGAVDIVVNNAGINRDAMLHKLSEADWDTVIDVNLKGTFLCM
QQAAIRMRERGAGRIINIASASWLGNVGQTNYSASKAGVVGMTKTACRELAKKGVTVNAI
CPGFIDTDMTRGVPENVWQIMINKIPAGYAGEAKDVGECVAFLASDGARYINGEVINVGG
GMVL