Protein Info for BWI76_RS23690 in Klebsiella michiganensis M5al

Annotation: putative glyoxalase/bleomycin resistance protein/dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 8 to 124 (117 residues), 61.1 bits, E=1.4e-20
• PF13669: Glyoxalase_4
  • amino acids 10 to 104 (95 residues), 48 bits, E=1.4e-16

Best Hits

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 97% identity to kpn:KPN_01697)

Predicted SEED Role

No annotation

MetaCyc Pathways

• methylglyoxal degradation I (2/3 steps found)
• methylglyoxal degradation VIII (2/3 steps found)
• superpathway of methylglyoxal degradation (5/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

See A0A285B928 at UniProt or InterPro

Protein Sequence (129 amino acids)

>BWI76_RS23690 putative glyoxalase/bleomycin resistance protein/dioxygenase (Klebsiella michiganensis M5al)
MRELINTIAHIGYQVSDLTRSLAFYEPLGFQRQQRFSKPSPQGTIEVAFLEMAGAVLELY
QLPAGTPFDAPRCGIDHLALEVRDLDAVQQRLAALGYPLDEGPIEEENVRFLLIRGPDGE
RLEFDAFKR