Protein Info for BWI76_RS23685 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 122 to 139 (18 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 390 to 410 (21 residues), see Phobius details amino acids 418 to 440 (23 residues), see Phobius details TIGR00885: L-fucose:H+ symporter permease" amino acids 32 to 437 (406 residues), 377.5 bits, see alignment E=5e-117 PF07690: MFS_1" amino acids 39 to 397 (359 residues), 79.3 bits, see alignment E=2.7e-26

Best Hits

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 97% identity to kpu:KP1_2750)

Predicted SEED Role

"Homolog of fucose/glucose/galactose permeases" in subsystem Hexose Phosphate Uptake System

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B9F9 at UniProt or InterPro

Protein Sequence (444 amino acids)

>BWI76_RS23685 MFS transporter (Klebsiella michiganensis M5al)
MSTLITDKVDKAAVHNEKLDTSAYLPHTPWLQFLLVCCLFALWGMAGNLNDILIAQFKKG
FDLTDTQTALVQSIFFLGYFFVALPAAALIKRYSYKAAIIIGLCLYALGCFLFVPAAQIM
TYGAFLACLGVIACGLSFLETSANTYSSLLGPIQSSTQRINFSQIFNSLGVISGVLIGQV
MVFGENDPSHEQLLAMPAAAADAARHQMVGQVVGPYLIIGSVLVVLALVFVFIKFPSCKG
TPSQQQQIPTESMGSTLKRLFAIPRFRLGILSQFLYVGAQVGVWSFTIRFVQLVQQGTSE
HSATYWLLASLVIYAVGKTVATWLMNRLNPALLLGTFALAATVLLLIAVFSSSMLAVYAL
ILVSFCMAPCWPTNFGLVIKGMGKDTQTAGSIVVMSIIGGAVIPLVMGIISDMNGGNMQI
AFIAPLLCFVYVAFYGFWCVRKGV