Protein Info for BWI76_RS23525 in Klebsiella michiganensis M5al

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 57 (19 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details PF00892: EamA" amino acids 13 to 138 (126 residues), 56.7 bits, see alignment E=1.5e-19 amino acids 148 to 281 (134 residues), 71.8 bits, see alignment E=3.2e-24

Best Hits

KEGG orthology group: None (inferred from 87% identity to kpu:KP1_4564)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B853 at UniProt or InterPro

Protein Sequence (296 amino acids)

>BWI76_RS23525 EamA family transporter (Klebsiella michiganensis M5al)
MAFVSRNLIVDLLLTALAPVIWGSTYIVTSQFLPPDRPFIAALLRVLPAGIALLIWSRRL
PLRAEWWKLIVTGILNIGAFQALLFIAAYRLPGGLAAVIGAIQPLLVMLLAWCVDRQRSP
WLAVLSALMGIAGMAMLLLSPQTTLEPLGITAAFLGAMSMALGTWLSRRWAIALPVVALT
GWQLLIGGIVLAPMAFLVDPPLHHVTLTQAAGYLWLCVAGAMLAYGLWFRGIGRLSPVAV
SAMSLLSPVTAVLLGWIFLGQKIEGMALVGLVIVLLSVLSIQRALSNKRAVVDRRR