Protein Info for BWI76_RS23500 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00345: PapD_N" amino acids 21 to 145 (125 residues), 136 bits, see alignment E=7.1e-44 PF02753: PapD_C" amino acids 166 to 226 (61 residues), 52.4 bits, see alignment E=5.3e-18

Best Hits

Swiss-Prot: 98% identical to MRKB_KLEPN: Chaperone protein MrkB (mrkB) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 95% identity to cko:CKO_00962)

Predicted SEED Role

"FIG00731973: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B828 at UniProt or InterPro

Protein Sequence (233 amino acids)

>BWI76_RS23500 hypothetical protein (Klebsiella michiganensis M5al)
MKRIALFFCFIFSFAAHANNIIVNGTRFIYPGNEKEITVQLSNTADRPALAQAWLDNGNA
DATPDTITTPFIITPPISRVDAKSGQTLRIKLGSSAGLAKDKETLWWLNLLEIPPVEASQ
KNEGQNILQLAIRSRFKFIYRPSGLGNRDAAAEKLALSANGSSLSVSNPTPFYITVSRIS
RNGGKALNSKTVMFAPQSSQTIALSSAVSKGEILTVNNINDYGADVAVKVTVK