Protein Info for BWI76_RS23415 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 48 to 67 (20 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 377 to 396 (20 residues), see Phobius details TIGR00882: oligosaccharide:H+ symporter" amino acids 9 to 396 (388 residues), 422.1 bits, see alignment E=1.1e-130 PF01306: LacY_symp" amino acids 10 to 401 (392 residues), 424.6 bits, see alignment E=6e-131 PF12832: MFS_1_like" amino acids 13 to 346 (334 residues), 76.5 bits, see alignment E=3.2e-25 PF07690: MFS_1" amino acids 14 to 307 (294 residues), 60.1 bits, see alignment E=2.8e-20

Best Hits

Swiss-Prot: 40% identical to RAFB_ECOLX: Raffinose permease (rafB) from Escherichia coli

KEGG orthology group: K02532, MFS transporter, OHS family, lactose permease (inferred from 94% identity to kva:Kvar_0808)

Predicted SEED Role

"Sucrose permease, major facilitator superfamily" in subsystem Sucrose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7Z3 at UniProt or InterPro

Protein Sequence (413 amino acids)

>BWI76_RS23415 MFS transporter (Klebsiella michiganensis M5al)
MMKAHPSQSYPLLSALLFFFFVTWSSSGSLLSIWLHQEVGLKPGDTGIIFSVLSVSALFA
QVCYGFIQDKLGLRKNLLWYITVLLILSGPAYMLFGYLLKINVLLGSIFGGIYIGLTFNG
GIGVLESYTERVARQSQFEFGKARMWGSLGWAVATFFAGLLFNINPHLNFAVASCSGLVF
FILLARLRVSSAPHAMQEAVSGGKVTLEDALRLLTLPRFWALVFFVIGTCIYGVYDQQFP
VYFSSQFPTLQEGNEMYGYLNSFQVFLEAAGMFCAPWLVNRIGAKNGLIFAGMVMAMRMV
ASGLVEGPLLISITKLLHAVELPVLLVSIFKYNSLNFDKRLSSTLYLVGFACTSSVIATV
LSPLAGYSYEKYGFAQSYLIMGLLVFCTTFISIFLLRSSKSSSDPLMPQTSAI