Protein Info for BWI76_RS23375 in Klebsiella michiganensis M5al

Annotation: cupin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07883: Cupin_2
  • amino acids 32 to 89 (58 residues), 57.8 bits, E=7.2e-20
• PF02311: AraC_binding
  • amino acids 42 to 86 (45 residues), 28.4 bits, E=1.2e-10

Best Hits

Swiss-Prot: 43% identical to KDGF_DICD3: Pectin degradation protein KdgF (kdgF) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 94% identity to cro:ROD_28851)

MetaCyc: 44% identical to unsaturated pyranuronate lyase monomer (Yersinia enterocolitica)
RXN-12877 [EC: 4.2.99.25]; 4.2.99.25 [EC: 4.2.99.25]

Predicted SEED Role

"Pectin degradation protein KdgF" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

MetaCyc Pathways

• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
• alginate degradation (2/7 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.25

Sequence Analysis Tools

See A0A285B7R5 at UniProt or InterPro

Protein Sequence (108 amino acids)

>BWI76_RS23375 cupin (Klebsiella michiganensis M5al)
MFIFHKETTLEDLGNGVTRRILAHDGKMMAVEVNFEAGAIGPMHNHPHEQLTYVLSGEFE
FTIGDEKHVVSAGDTLYKKPNIMHGCVCLKSGTLLDTFTPVRQDFLQQ