Protein Info for BWI76_RS23350 in Klebsiella michiganensis M5al

Annotation: PTS system lactose/cellobiose family transporter subunit IIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 265 to 281 (17 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details amino acids 351 to 375 (25 residues), see Phobius details amino acids 394 to 419 (26 residues), see Phobius details TIGR00410: PTS system, lactose/cellobiose family IIC component" amino acids 14 to 429 (416 residues), 373.1 bits, see alignment E=1e-115 PF02378: PTS_EIIC" amino acids 29 to 360 (332 residues), 162.1 bits, see alignment E=9.1e-52

Best Hits

KEGG orthology group: K02761, PTS system, cellobiose-specific IIC component (inferred from 94% identity to kpu:KP1_4524)

Predicted SEED Role

"PTS system, cellobiose-specific IIC component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B848 at UniProt or InterPro

Protein Sequence (445 amino acids)

>BWI76_RS23350 PTS system lactose/cellobiose family transporter subunit IIC (Klebsiella michiganensis M5al)
MALQDKLIDSLGSFATKFNSYRYIMAIKSAFITLMPVIIVGAFSVLISNMVLDPKNGLAS
FQALSFLAALKPITSAINYATLNFLNIGAVFLIGIELGRINGIKSLFPGLLAVICFICVT
PTTVEMMVDGQMHEVKDVLLRQFSDTRSLFLGMFIAILSVEIYCWLEGRKGLKIKMPDTV
PPNVSASFSALIPAIITTTVIATFGFIFHQATGMYLYDAVYQVVQQPLERVVQSLPGILL
LMFVAQLFWVIGIHGNQMIKPIREPLLLGAIAVNMSAFEQGKEVPNIITMPFWDVYMSIG
GSGLTIGLLIAVMIATKRKEMKEIAKLSIGPGLFNINEPVIFGMPIMLNPILAIPFIITP
LVTGSIGYFATAAGFAGKAVVMVPWTTPPLINAWLSTAGSMGAVVTQLICILTAVLIYLP
FVKIASRRAENAQRQAENTPTSQQI