Protein Info for BWI76_RS23330 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator GalR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF00356: LacI" amino acids 3 to 48 (46 residues), 75.5 bits, see alignment 4.3e-25 PF00532: Peripla_BP_1" amino acids 60 to 274 (215 residues), 88.7 bits, see alignment E=9.6e-29 PF13407: Peripla_BP_4" amino acids 62 to 274 (213 residues), 45 bits, see alignment E=2e-15 PF13377: Peripla_BP_3" amino acids 169 to 329 (161 residues), 123.7 bits, see alignment E=1.7e-39

Best Hits

Swiss-Prot: 90% identical to GALR_ECOLI: HTH-type transcriptional regulator GalR (galR) from Escherichia coli (strain K12)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 94% identity to kva:Kvar_0824)

Predicted SEED Role

"Galactose operon repressor, GalR-LacI family of transcriptional regulators" in subsystem Lactose and Galactose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7R2 at UniProt or InterPro

Protein Sequence (338 amino acids)

>BWI76_RS23330 transcriptional regulator GalR (Klebsiella michiganensis M5al)
MATIKDVARLAGVSVATVSRVINNSPKASEASRQSVGAAMETLNYHPNANARALAQQSTE
TVGLVVGDVSDPFFGAMVKAVEQVAYNTGNFLLIGNGYHNLHKERQAIEQLIRHRCAALV
VHAKIIPDDELASLMKQIPGMVLINRILPGFEQRCVALDDRYGAWLATRHLIQQGHTRIG
YLCSNHAISDAEDRLQGYYAALKESDLPCNDRLVTFAEPDESGGEQAITELLGRGRNFSA
VACYNDSMAAGAMGVLNDNGIDVPREISLIGFDDVLISRYVRPRLTTVRYPIVTMATQAA
ELALALAEHRPPPEITHLFSPTLVRRHSVIAPLDSDKS