Protein Info for BWI76_RS23220 in Klebsiella michiganensis M5al

Annotation: amino-acid N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 TIGR01890: amino-acid N-acetyltransferase" amino acids 9 to 442 (434 residues), 654.8 bits, see alignment E=3.1e-201 PF00696: AA_kinase" amino acids 26 to 269 (244 residues), 135 bits, see alignment E=5.3e-43 PF00583: Acetyltransf_1" amino acids 328 to 413 (86 residues), 43.5 bits, see alignment E=5.4e-15 PF13508: Acetyltransf_7" amino acids 336 to 414 (79 residues), 35.7 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 93% identical to ARGA_ECOLI: Amino-acid acetyltransferase (argA) from Escherichia coli (strain K12)

KEGG orthology group: K14682, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 97% identity to kpu:KP1_4495)

MetaCyc: 93% identical to N-acetylglutamate synthase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B8C1 at UniProt or InterPro

Protein Sequence (443 amino acids)

>BWI76_RS23220 amino-acid N-acetyltransferase (Klebsiella michiganensis M5al)
MVKERRTELVEGFRHSVPYINAHRGKTFVIMLGGEAIEHDNFSSIVNDIGLLHSLGIRLV
VVYGARPQIDANLAEHRHEPVYHKQTRVTDAKTLELVKQAAGMLQLEITARLSMSLNNTP
LQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEEAIHRQLDNGAIVLMGPVAVSV
TGESFNLTSEEIATQLAIKLKAEKMIGFCSSQGVYNQDGEIVPELFPNEAQARVEEIEAD
EDYSSGTVRFLRGAVKACRSGVRRCHLISYQENGTLLQELFSRDGIGTQIVMESAEQIRR
ATINDIGGILELISPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKI
GEMACVAVHPDYRSSSRGEVLLERIAAQAKQMGLSKLFVLTTRSIHWFQERGFTPVDVDL
LPESKKEMYNYQRRSKVLMADLA