Protein Info for BWI76_RS23205 in Klebsiella michiganensis M5al

Annotation: propanediol utilization protein PduX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 74% identical to PDUX_SALTY: L-threonine kinase (pduX) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 77% identity to cro:ROD_21441)

MetaCyc: 74% identical to L-threonine kinase (Salmonella enterica enterica serovar Typhimurium)
RXN-8626 [EC: 2.7.1.177]

Predicted SEED Role

"Threonine kinase in B12 biosynthesis" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis or Propanediol utilization

MetaCyc Pathways

adenosylcobalamin biosynthesis II (aerobic) (29/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (31/36 steps found)
superpathway of L-threonine metabolism (18/18 steps found)
aminopropanol phosphate biosynthesis I (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.177

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7X1 at UniProt or InterPro

Protein Sequence (288 amino acids)

>BWI76_RS23205 propanediol utilization protein PduX (Klebsiella michiganensis M5al)
MAVAQCPASCGELIQGWILGSEKLVSCPVDWYSTVEVDYGSPRADERPLSRAMVDRLLGY
WRYPAELGKEIRIDICSTIPVAKGMASSTADIAATAVATAHHLGHPLDETTLARLCVSLE
PTDSTLFRQLTLFDHNTAATQITCGCQPQLDLLVLESPATLLTTDYHRLPRLEKLHAHSA
ALHQAWEKVQQACQTNDPRRMGEAATLSAIASQHLLPKPGFDTLRALVEECDLYGINVAH
SGSVVGLMLDRQRHDIEYLQRRLQETRLSELWPRQHLLRMVQGGVELR