Protein Info for BWI76_RS23175 in Klebsiella michiganensis M5al

Annotation: propanediol utilization protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF00465: Fe-ADH" amino acids 8 to 362 (355 residues), 361.7 bits, see alignment E=3.8e-112 PF13685: Fe-ADH_2" amino acids 24 to 259 (236 residues), 62.5 bits, see alignment E=5.5e-21

Best Hits

KEGG orthology group: K13921, 1-propanol dehydrogenase (inferred from 95% identity to seh:SeHA_C2275)

MetaCyc: 96% identical to propanol dehydrogenase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Alcohol dehydrogenase. [EC: 1.1.1.1]

Predicted SEED Role

"Putative iron-containing NADPH-dependent propanol dehydrogenase" in subsystem Propanediol utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7M8 at UniProt or InterPro

Protein Sequence (370 amino acids)

>BWI76_RS23175 propanediol utilization protein (Klebsiella michiganensis M5al)
MKTFSLQTRLYSGQGSLAALKRFTNKHIWIICDGFLARSPLLETLRNALPADNRISVFSE
ITPDPTIHTVVQGIAQMQALQPQVVIGFGGGSAMDAAKAIVWFSQQSGISIETCVAIPTT
SGTGSEVTSACVISDPDKGIKYPLFNNALYPDMAILDPELVVSVPPQITANTGMDVLTHA
LEAWVSPHASDFTDALAEKAAKLVFQYLPTAVEKGDCVATRGKMHNASTLAGMAFSQAGL
GLNHAIAHQLGGQFHLPHGLANALLLTTVIRFNAAVPRAGKRYARLAKACGFCPAEANDV
TAINALIQQIERLKQRCALPSLAIALKEGRSEFSARIPAMVQAALADVTLRTNPRPASAE
EIRELLEELL