Protein Info for BWI76_RS23160 in Klebsiella michiganensis M5al

Annotation: ethanolamine utilization protein EutN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 PF03319: EutN_CcmL" amino acids 1 to 87 (87 residues), 96.8 bits, see alignment E=4.4e-32

Best Hits

Swiss-Prot: 46% identical to EUTN_SALTY: Ethanolamine utilization protein EutN (eutN) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 97% identity to cro:ROD_21351)

Predicted SEED Role

"Propanediol utilization polyhedral body protein PduN" in subsystem Propanediol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7M9 at UniProt or InterPro

Protein Sequence (91 amino acids)

>BWI76_RS23160 ethanolamine utilization protein EutN (Klebsiella michiganensis M5al)
MHLARVTGAVVSTQKSPSLVGKKLLLVRRVSADGELPASPTSGDEVAVDSVGAGVGELVL
LSGGSSARHVFSGPNEAIDLAVVGIVDTLSR