Protein Info for BWI76_RS23130 in Klebsiella michiganensis M5al

Annotation: diol dehydratase reactivase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 TIGR04491: diol dehydratase reactivase alpha subunit" amino acids 3 to 601 (599 residues), 944.7 bits, see alignment E=9.9e-289 PF18427: DDR_swiveling" amino acids 93 to 254 (162 residues), 251 bits, see alignment E=5.4e-79 PF08841: DDR" amino acids 275 to 602 (328 residues), 539.6 bits, see alignment E=2.5e-166

Best Hits

Swiss-Prot: 98% identical to DDRFA_KLEOK: Diol dehydratase-reactivating factor alpha subunit (ddrA) from Klebsiella oxytoca (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686)

KEGG orthology group: None (inferred from 97% identity to seh:SeHA_C2266)

Predicted SEED Role

"Propanediol dehydratase reactivation factor large subunit" in subsystem Propanediol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7W8 at UniProt or InterPro

Protein Sequence (610 amino acids)

>BWI76_RS23130 diol dehydratase reactivase subunit alpha (Klebsiella michiganensis M5al)
MRYIAGIDIGNSSTEVALATLDEAGALTITHSALAETTGIKGTLRNVFGIQEALALVAKR
AGIGVGDISLIRINEATPVIGDVAMETITETIITESTMIGHNPKTPGGVGLGVGITITPQ
ELLTRPAEAPYILVVSSAFDFADIANVINASLRAGYQITGVILQRDDGVLVSNRLEKPLP
IVDEVLYIDRIPLGMLAAIEVAVPGKVIETLSNPYGIATVFNLNAEETKNIVPMARALIG
NRSAVVVKTPSGDVKARAIPAGNLALLAQGRSVRVDVAAGAEAIMKAVDGCGRLDNVTGE
SGTNIGGMLEHVRQTMAELTNKPSSEIFIQDLLAVDTSVPVSVTGGLAGEFSLEQAVGIA
SMVKSDRLQMAMIAREIEQKLNIDVQIGGAEAEAAILGALTTPGTTRPLAILDLGAGSTD
ASIINPKGEIIATHLAGAGDMVTMIIARELGLEDRYLAEEIKKFPLAKVESLFHLRHEDG
SVQFFSTPLPPAVFARVCVVKPGELVPLPGDLALEKVRAIRRSAKERVFVTNALRALRQV
SPTGNIRDIPFVVLVGGSSLDFEVPQLVTDALAHYRLVAGRGNIRGSEGPRNAVATGLIL
SWHKEFAHGQ