Protein Info for BWI76_RS23120 in Klebsiella michiganensis M5al

Annotation: propanediol dehydratase medium subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF02288: Dehydratase_MU" amino acids 64 to 176 (113 residues), 123.6 bits, see alignment E=1.7e-40

Best Hits

Swiss-Prot: 96% identical to PDUD_SALTY: Propanediol dehydratase medium subunit (pduD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13919, propanediol dehydratase medium subunit [EC: 4.2.1.28] (inferred from 91% identity to ses:SARI_00846)

MetaCyc: 96% identical to propanediol dehydratase medium subunit (Salmonella enterica enterica serovar Typhimurium str. LT2)
Propanediol dehydratase. [EC: 4.2.1.28]; 4.2.1.28 [EC: 4.2.1.28]

Predicted SEED Role

"Propanediol dehydratase medium subunit (EC 4.2.1.28)" in subsystem Propanediol utilization (EC 4.2.1.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.28

Use Curated BLAST to search for 4.2.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B8A4 at UniProt or InterPro

Protein Sequence (219 amino acids)

>BWI76_RS23120 propanediol dehydratase medium subunit (Klebsiella michiganensis M5al)
MEINEKLLRQIIEDVLSEMKGSDKPVSFNAPAASAAPAGDGFLTEVGEARQGTQQDEVII
AVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSG
SGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLDTYRQIGKNAARYAKRESPQPVP
TLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVAL