Protein Info for BWI76_RS23100 in Klebsiella michiganensis M5al
Annotation: aquaporin
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 87% identical to PDUF_SALTY: Propanediol diffusion facilitator (pduF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: None (inferred from 88% identity to cko:CKO_00799)MetaCyc: 68% identical to glycerol facilitator (Escherichia coli K-12 substr. MG1655)
RXN0-7189; RXN0-7191; TRANS-RXN-131; TRANS-RXN0-460; TRANS-RXN0-536; TRANS-RXN0-537; TRANS-RXN0-551
Predicted SEED Role
No annotation
MetaCyc Pathways
- glycerol and glycerophosphodiester degradation (4/4 steps found)
- glycerol degradation I (3/3 steps found)
- arsenic detoxification (plants) (5/6 steps found)
- arsenate detoxification III (2/2 steps found)
- arsenic detoxification (mammals) (8/17 steps found)
- arsenic detoxification (yeast) (4/12 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B7P3 at UniProt or InterPro
Protein Sequence (266 amino acids)
>BWI76_RS23100 aquaporin (Klebsiella michiganensis M5al) MNDSLKAQCTAEFLGTGLFLFFGIGCLSALKVAGASLGLWEICIIWGLGISLAVYLTSGI SGGHLNPAVTVALWLFACFPGRKVFPYIVSQVAGAFGGAVLAYVLYSTMFTEFESAHHIA RGSVESLQLASIFSTYPAASLSIWHAALVEVVITSMLMGMIMALTDDGNGVPKGPLAPLL IGLLVAVIGASTGPLTGFAMNPARDFGPKLFTWMAGWGDIAMTGGRDIPYFIVPIIAPLI GACLGAAIYRYLIGNNLPCNTCKLED